Emmalynnschickenandwaffles Status Report

Emma Lynn's Chicken and Waffles - Byron Center | View our menu, reviews & Order food online
Website is Online when last checked on 25 November 2016
This report has been viewed 0 times since it was first created on 21 January 2016

Emmalynnschickenandwaffles.net is a 11 months old domain, situated in United States. The domain is linked to the IP address which is provided by the hosting company Latisys-Chicago, LLC.

It was registered by WEBMASTER GRUBHUB , who can be reached at . Registration details show that it was registered on 08 Jan 2016 through eNom and will expire on 08 Jan 2017.

The site returns a status code of 200.

Registration Details

This data reveals what information was provided to the site registrar eNom when emmalynnschickenandwaffles.net was registered.
08 Jan
08 Jan
Expiry of registration
08 Jan
Registrar eNom
Reseller namecheap.com
Status clientTransferProhibited https://www.icann.org/eppRegistry Registrant ID:
Organisation -
United States
Organisation -
United States
Name -
Organisation -
Organisation -
United States

SEO Analysis

Get a free On page SEO analysis report of emmalynnschickenandwaffles.net
  1. Page Title: Too Big (91 characters)
    Emma Lynn's Chicken and Waffles - Byron Center | View our menu, reviews & Order food online
    Page title is too big, which is not good for SEO.
  2. Meta Description: Too Long (174 characters)
    View our menu and reviews for Emma Lynn's Chicken and Waffles located at 530 76th St SW Ste 500 - Byron Center. We serve Breakfast, Chicken, Dinner. Order delivery & Takeout.
    Meta description isn't used in SEO signals anymore, but is still relevant as it explains the site purpose in search results.
  3. Meta Keywords: 127 characters
    Emma Lynn's Chicken and Waffles Breakfast, Chicken, Dinner Byron Center delivery pickup takeout carryout 530 76th St SW Ste 500
    Meta keywords are ignored by search engines. We are referring them, because they too show the site purpose just like meta description.
  4. Compression: Enabled
    Compression increases the speed of the website. Header data sent by the website shows that compression is properly configured on the website.
  5. Mobile Optimised: Yes
    Responsive design is being used on the website, which is extremely important nowadays.
  6. Outgoing links: 1 links found.
    Site has links to 1 other websites on its front page.
  7. Content Rating: Safe
    The content of the site seems to be safe for all age groups.
  8. Language: English

Technical Background

Important background details of the website
    Website home page is 6 kB in size.

IP Address Details

All stuff related to IP address of the website.
Primary IP Address
IPv6 Address
  • Server country: United States
  • DNS is hosted by eNom
  • Web Hosting: Latisys-Chicago, LLC