Emmalynnschickenandwaffles Status Report

Website is Offline when last checked on 20 May 2017
This report has been viewed 0 times since it was first created on 21 January 2016

Emmalynnschickenandwaffles.net is a 1 year old domain, situated in United States. The domain is linked to the IP address which is provided by the hosting company Latisys-Chicago, LLC.

It was registered by WEBMASTER GRUBHUB , who can be reached at . Registration details show that it was registered on 08 Jan 2016 through eNom and will expire on 08 Jan 2017.

The site is being served through Microsoft-IIS/8.5.

Registration Details

This data reveals what information was provided to the site registrar eNom when emmalynnschickenandwaffles.net was registered.
08 Jan
08 Jan
Expiry of registration
08 Jan
Registrar eNom
Reseller namecheap.com
Status clientTransferProhibited https://www.icann.org/eppRegistry Registrant ID:
Organisation -
United States
Organisation -
United States
Name -
Organisation -
Organisation -
United States

SEO Analysis

Get a free On page SEO analysis report of emmalynnschickenandwaffles.net
  1. Page Title: Small (30 characters)
    Page title is small, which is bad for SEO.
  2. Meta Description: Too Long (200 characters)
    Find Cash Advance, Debt Consolidation and more at Emmalynnschickenandwaffles.net. Get the best of Insurance or Free Credit Report, browse our section on Cell Phones or learn about Life Insurance. Emma
    Meta description isn't used in SEO signals anymore, but is still relevant as it explains the site purpose in search results.
  3. Meta Keywords: 72 characters
    cash advance debt consolidation insurance emmalynnschickenandwaffles.net
    Meta keywords are ignored by search engines. We are referring them, because they too show the site purpose just like meta description.
  4. Compression: Disabled
    Compression increases the speed of the website. Our system couldn't detect compression on the site page, which affects the site negatively on the scale of speed, efficiency and SEO score.
  5. Mobile Optimised: Yes
    Responsive design is being used on the website, which is extremely important nowadays.
  6. Outgoing links: 1 links found.
    Site has links to 1 other websites on its front page.
  7. Content Rating: Safe
    The content of the site seems to be safe for all age groups.
  8. Language: English

Technical Background

Important background details of the website
    Google Analytics is being used to track visitors on the website. Website home page is 7 kB in size.

IP Address Details

All stuff related to IP address of the website.
Primary IP Address
IPv6 Address
  • Server country: United States
  • DNS is hosted by eNom
  • Web Hosting: Latisys-Chicago, LLC