Wendykramerappraisalservices Status Report

Website is Offline when last checked on 22 April 2017
This report has been viewed 2 times since it was first created on 20 January 2016

Wendykramerappraisalservices.com is a 1 year old domain.

It was registered by WENDY KRAMER , who can be reached at . The site is owned by KRAMER APPRAISAL SERVICES. Registration details show that it was registered on 07 Jan 2016 through eNom and will expire on 07 Jan 2017.

The site is being served through Microsoft-IIS/8.5.

Registration Details

This data reveals what information was provided to the site registrar eNom when wendykramerappraisalservices.com was registered.
Registered by WENDY KRAMER
07 Jan
07 Jan
Expiry of registration
07 Jan
Registrar eNom
Reseller -
Status clientTransferProhibited https://www.icann.org/eppRegistry Registrant ID:
United States
+1.9516991236 +1.9516991207
United States
+1.9516991236 +1.9516991207
Name -
Organisation -
Organisation A LA MODE, INC.
United States
+1.4053596587 +1.4053598612

SEO Analysis

Get a free On page SEO analysis report of wendykramerappraisalservices.com
  1. Page Title: Adequate Length (32 characters)
    Page title is of adequate length, which is good for SEO.
  2. Meta Description: Too Long (200 characters)
    Find Cash Advance, Debt Consolidation and more at Wendykramerappraisalservices.com. Get the best of Insurance or Free Credit Report, browse our section on Cell Phones or learn about Life Insurance. We
    Meta description isn't used in SEO signals anymore, but is still relevant as it explains the site purpose in search results.
  3. Meta Keywords: 74 characters
    cash advance debt consolidation insurance wendykramerappraisalservices.com
    Meta keywords are ignored by search engines. We are referring them, because they too show the site purpose just like meta description.
  4. Compression: Disabled
    Compression increases the speed of the website. Our system couldn't detect compression on the site page, which affects the site negatively on the scale of speed, efficiency and SEO score.
  5. Mobile Optimised: Yes
    Responsive design is being used on the website, which is extremely important nowadays.
  6. Outgoing links: 3 links found.
    Site has links to 3 other websites on its front page.
  7. Content Rating: Safe
    The content of the site seems to be safe for all age groups.
  8. Language: English

Technical Background

Important background details of the website
    Google Analytics is being used to track visitors on the website. Website home page is 7 kB in size.

IP Address Details

All stuff related to IP address of the website.
Sorry, no IP information is present for this website.