Emmalynnschickenandwaffles Status Report

Website is Offline when last checked on 04 April 2018
This report has been viewed 0 times since it was first created on 21 January 2016

Emmalynnschickenandwaffles.net is a 2 years old domain, situated in United States. The domain is linked to the IP address which is provided by the hosting company Latisys-Chicago, LLC.

It was registered by WEBMASTER GRUBHUB , who can be reached at . Registration details show that it was registered on 08 Jan 2016 through eNom and will expire on 08 Jan 2017.

The site is being served through Microsoft-IIS/8.5.

Registration Details

This data reveals what information was provided to the site registrar eNom when emmalynnschickenandwaffles.net was registered.
08 Jan
08 Jan
Expiry of registration
08 Jan
Registrar eNom
Reseller namecheap.com
Status clientTransferProhibited https://www.icann.org/eppRegistry Registrant ID:
Organisation -
United States
Organisation -
United States
Name -
Organisation -
Organisation -
United States

SEO Analysis

Get a free On page SEO analysis report of emmalynnschickenandwaffles.net
  1. Page Title: Small (30 characters)
    Page title is small, which is bad for SEO.
  2. Meta Description: Too Long (200 characters)
    Find Cash Advance, Debt Consolidation and more at Emmalynnschickenandwaffles.net. Get the best of Insurance or Free Credit Report, browse our section on Cell Phones or learn about Life Insurance. Emma
    Meta description isn't used in SEO signals anymore, but is still relevant as it explains the site purpose in search results.
  3. Meta Keywords: 72 characters
    cash advance debt consolidation insurance emmalynnschickenandwaffles.net
    Meta keywords are ignored by search engines. We are referring them, because they too show the site purpose just like meta description.
  4. Compression: Disabled
    Compression increases the speed of the website. Our system couldn't detect compression on the site page, which affects the site negatively on the scale of speed, efficiency and SEO score.
  5. Mobile Optimised: Yes
    Responsive design is being used on the website, which is extremely important nowadays.
  6. Outgoing links: 1 links found.
    Site has links to 1 other websites on its front page.
  7. Content Rating: Safe
    The content of the site seems to be safe for all age groups.
  8. Language: English

Technical Background

Important background details of the website
    Google Analytics is being used to track visitors on the website. Website home page is 7 kB in size.

IP Address Details

All stuff related to IP address of the website.
Primary IP Address
IPv6 Address
  • Server country: United States
  • DNS is hosted by eNom
  • Web Hosting: Latisys-Chicago, LLC

Complete whois text

Whois Server Version 2.0

   Registrar: ENOM, INC.
   Sponsoring Registrar IANA ID: 48
   Whois Server: whois.enom.com
   Referral URL: 
   Status: clientTransferProhibited    Updated Date: 08-jan-2016
   Creation Date: 08-jan-2016
   Expiration Date: 08-jan-2017

For more information on Whois status codes, please visit

The Registry database contains ONLY .COM, .NET, .EDU domains and

Registry Domain ID: 1992766493_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2016-01-08T15:42:28.00Z
Creation Date: 2016-01-08T23:42:00.00Z
Registrar Registration Expiration Date: 2017-01-08T23:42:00.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited  Registrant ID: 
Registrant Organization: 
Registrant Street: 111 W. WASHINGTON ST.
Registrant Street: STE. 2100
Registrant City: CHICAGO
Registrant State/Province: IL
Registrant Postal Code: 60602
Registrant Country: US
Registrant Phone: +1.8775857878
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: 
Registry Admin ID: 
Admin Organization: 
Admin Street: 111 W. WASHINGTON ST.
Admin Street: STE. 2100
Admin City: CHICAGO
Admin State/Province: IL
Admin Postal Code: 60602
Admin Country: US
Admin Phone: +1.8775857878
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext:
Admin Email: 
Registry Tech ID: 
Tech Organization: 
Tech Street: 111 W. WASHINGTON ST.
Tech Street: STE. 2100
Tech City: CHICAGO
Tech State/Province: IL
Tech Postal Code: 60602
Tech Country: US
Tech Phone: +1.8775857878
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: 
DNSSEC: unSigned
Registrar Abuse Contact Email: 
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: 
Last update of WHOIS database: 2016-01-08T15:42:28.00Z

We reserve the right to modify these terms at any time. By submitting 
this query, you agree to abide by these terms.
Version 6.3 4/3/2002